DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and nas-27

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_493926.2 Gene:nas-27 / 188809 WormBaseID:WBGene00003545 Length:428 Species:Caenorhabditis elegans


Alignment Length:247 Identity:70/247 - (28%)
Similarity:111/247 - (44%) Gaps:20/247 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VIFGLGSSANGRPSIK-LQEDDIILISEQLQY-FEGNLEGRVVKS--------WSEYYWKGRTLV 62
            :|..|.:...||.::: ..|.||..:....|| ::|::  .||||        .....|| ..:.
 Worm    11 LITSLHAIPRGRRAVRNRNEGDINSLVGVGQYLYQGDI--AVVKSRARRAVIRQKHKKWK-LPMP 72

  Fly    63 YSYAGGFSSLDIASIESAMAEISSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVG-YLGRADQTL 126
            ||:...|.|.....:..||...|.||||.|....|. .|.|.| .||:||||:|| .....:|:|
 Worm    73 YSFDRNFPSRSRQRVLEAMQFWSEKTCVTFHENRYV-YPHVSI-FEGNGCWSFVGKQPSLREQSL 135

  Fly   127 NLGSGCMSNR-TIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFG 190
            :|...|..:. .:.||:.|.|||:|.|:...||:::.|...|:.......|.:.....:.:....
 Worm   136 SLERSCTDHTFVVAHEIAHTLGFYHEHARGDRDQFISIDYSNVNPNLTFAFAKESEKQLDHQEAA 200

  Fly   191 YDYDSIMHYGPFAFSKNGQSTIV---PLKSHAKIGQATQMSPKDVQTLKRMY 239
            |:|.|:|||....|:.|....::   ..|....:|...:.:.:||..:..:|
 Worm   201 YEYGSVMHYSVDQFAVNTNRPVIYARDQKFAQAMGNRMRATFQDVSRMNVLY 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 55/187 (29%)
ZnMc_astacin_like 58..239 CDD:239807 53/185 (29%)
nas-27NP_493926.2 Astacin 65..254 CDD:279708 56/191 (29%)
ZnMc_astacin_like 70..252 CDD:239807 53/183 (29%)
CUB 334..410 CDD:294042
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.