DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and nas-3

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_505445.2 Gene:nas-3 / 187045 WormBaseID:WBGene00003522 Length:292 Species:Caenorhabditis elegans


Alignment Length:206 Identity:54/206 - (26%)
Similarity:86/206 - (41%) Gaps:41/206 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WSEYYWKGRTLVYSYAGGFSSLDIASIESAMAEISSKTCVKF--RRTEYKREPQVVIQKEGSGCW 113
            |..:.|....:.|..|..:::.:...|.|||......|||:|  ||:..|...|:....:...|:
 Worm    65 WESHLWPNAEVPYDIASHYTATERGIILSAMEAFRDVTCVRFRPRRSTDKHYLQINKHYQLERCF 129

  Fly   114 SYVG-----YL-----GRADQTLNLGSGCM---SNRTIQHELLHALGFFHTHSDPQRDKYVRIQT 165
            ||:|     :|     |:.:..:.|...|:   ...|:.|||:|.|||:|.|....||:.:.   
 Worm   130 SYIGRQSSRWLFGTRDGKVETRMKLDPSCLLYNGRGTVMHELMHILGFYHEHQRDDRDRRIG--- 191

  Fly   166 DNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMHY--GPFAFSKNGQSTIVPLKSHAKIGQATQMS 228
               .|...:|| ::.....:.|..|||.:|||||  |...:.|.                 ...|
 Worm   192 ---GSASHYNF-KIYQRAKSYYMGGYDANSIMHYNFGSVPWQKR-----------------DYFS 235

  Fly   229 PKDVQTLKRMY 239
            |.|::.:..:|
 Worm   236 PSDIRNINTLY 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 52/199 (26%)
ZnMc_astacin_like 58..239 CDD:239807 51/197 (26%)
nas-3NP_505445.2 Astacin 69..250 CDD:279708 53/202 (26%)
ZnMc 72..246 CDD:294052 51/197 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.