DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and nas-19

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_505893.2 Gene:nas-19 / 186926 WormBaseID:WBGene00003538 Length:396 Species:Caenorhabditis elegans


Alignment Length:201 Identity:53/201 - (26%)
Similarity:89/201 - (44%) Gaps:29/201 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KLQEDDIILISEQLQYFEGNLEGRVVKSWSEYY---WKGRTLVYSYAGGFSSLDIASIESAMAEI 84
            :|.|.||          |.:...:.||...|..   |....:.|.||...:.:. ..:|||:|.|
 Worm    24 RLNEHDI----------EESYSHKRVKRQFERLGTKWSYGVVNYYYADKNNEIK-EMVESAIAYI 77

  Fly    85 SSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVGYLGRA-----DQTLNLGSGCMSNRTIQHELLH 144
            ::.||::|...:...:...:..::...|.|.||..|.:     .:...|...|.:..:|.||..|
 Worm    78 ANHTCIRFNEDQNAVQRVQIRMQQNWLCQSTVGAPGMSMSKPIGELSMLVQSCDTIGSIVHEFSH 142

  Fly   145 ALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKNGQ 209
            :||.||.|:.|.||.::::.|    :.||   .|.|.:|:|.....:::.|:|.|....:   |.
 Worm   143 SLGRFHEHTRPDRDNFMKVTT----TVHE---ARPRPSGMTTMYGPFEHGSVMMYHADTY---GP 197

  Fly   210 STIVPL 215
            .|:.||
 Worm   198 GTMDPL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 45/165 (27%)
ZnMc_astacin_like 58..239 CDD:239807 44/163 (27%)
nas-19NP_505893.2 Astacin 48..230 CDD:279708 45/167 (27%)
ZnMc 53..228 CDD:294052 44/162 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.