DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and nas-31

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001023994.1 Gene:nas-31 / 186493 WormBaseID:WBGene00003549 Length:611 Species:Caenorhabditis elegans


Alignment Length:210 Identity:69/210 - (32%)
Similarity:100/210 - (47%) Gaps:31/210 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LQEDDIILISEQLQYFEGNLEGR---VVKSWS---------EYY----WKGRTLVYSYAGGFSSL 72
            |.:.|::|..:|:...   ||.|   .|.:.|         .||    | |.::.|.|....:..
 Worm   126 LYQGDMVLTDDQIATI---LEARDETTVSTASRARRQAYRDRYYPSTTW-GSSVYYYYDRTATPK 186

  Fly    73 DIASIESAMAEISSKTCVKFRRTEYKREPQVVIQK----EGSGCWSYVGYLGRADQTLNLGSGCM 133
            .:.:.|.|:|...:.||:...::      ...|.:    :|.||:||||.:... |.|:||:||.
 Worm   187 IVKAFEQAVAFWQNVTCINIMQS------STAINRIRVFKGQGCYSYVGRISGV-QDLSLGTGCE 244

  Fly   134 SNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMH 198
            ...|..|||.||||||||.|...||.|:.|...||...:...|.:..:|...|||..|||.|||.
 Worm   245 EFGTAAHELGHALGFFHTQSRYDRDNYISINYANIDPSYVEQFDKETSNTNFNYGMPYDYGSIMQ 309

  Fly   199 YGPFAFSKNGQSTIV 213
            ||..:.|.|.::|::
 Worm   310 YGATSASSNDKATMI 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 58/162 (36%)
ZnMc_astacin_like 58..239 CDD:239807 57/160 (36%)
nas-31NP_001023994.1 Astacin 169..355 CDD:279708 58/164 (35%)
ZnMc_astacin_like 175..351 CDD:239807 56/157 (36%)
ShKT 532..564 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.