DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and nas-2

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_503678.3 Gene:nas-2 / 186345 WormBaseID:WBGene00003521 Length:272 Species:Caenorhabditis elegans


Alignment Length:217 Identity:58/217 - (26%)
Similarity:91/217 - (41%) Gaps:44/217 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NGRPS---IK---LQEDDIILISEQLQYFEGNLEGRV-------------VKSWSEYYWKGRTLV 62
            |.||:   :|   :.|::|:   .:|..||.:..|.:             ...|:.|.|....:.
 Worm     5 NRRPTEPVLKRRGISENNIL---TKLPTFEPSKYGHINIPLRKKRGIALHPLQWASYLWPNAEVP 66

  Fly    63 YSYAGGFSSLDIASIESAMAEISSKTCVKFRRTEYKREPQVVIQK--EGSGCWSYVGYL------ 119
            |..|..::|.:.:.|.|||....:.|||:||......:..:.|.|  ....|:||:|..      
 Worm    67 YDIATHYTSTEKSIILSAMEAFKNVTCVRFRPRAATDKHYLQINKYFNVERCFSYIGRQSSRTLF 131

  Fly   120 ----GRADQTLNLGSGCMSNR---TIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQ 177
                |..:..:.|...|:...   .:.|||:|.|||:|.|....||:.:      :.|...:||:
 Worm   132 GTPEGNVETRMRLDPACLRGNGRGIVMHELMHILGFYHEHQRDDRDRRI------VGSAVHYNFK 190

  Fly   178 RLRANGVTNYGFGYDYDSIMHY 199
            ..| ...|.|...||.:|||||
 Worm   191 IYR-RAKTLYMGAYDANSIMHY 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 46/159 (29%)
ZnMc_astacin_like 58..239 CDD:239807 45/157 (29%)
nas-2NP_503678.3 Astacin 58..240 CDD:279708 47/161 (29%)
ZnMc 62..236 CDD:294052 45/157 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.