DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and nas-1

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_499768.2 Gene:nas-1 / 185811 WormBaseID:WBGene00003520 Length:270 Species:Caenorhabditis elegans


Alignment Length:189 Identity:66/189 - (34%)
Similarity:97/189 - (51%) Gaps:10/189 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 WKGRTLVYSYAGGFSSLDIASIESAMAEISSKTCVKFRRTEYKREPQVVIQKEGSGCW---SYVG 117
            |....:.|..:..::|...|.:..|....:.:||::|.......:..:||||. .||:   |.||
 Worm    80 WPNGRVPYILSAAYTSAQRAVLARAFDTYAKRTCIRFVPKSPADKDYIVIQKL-DGCYADFSRVG 143

  Fly   118 YLGRADQTLNLGSGCMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRAN 182
              ||  |.::|...|:...||.|||:|.:||.|.|....||.||.|...|:..|...:|.:|...
 Worm   144 --GR--QQVSLADECIDYATIIHELMHVIGFIHEHQREDRDSYVSILYQNVIQGANTDFDKLSNL 204

  Fly   183 GVTNYGFGYDYDSIMHYGPFAFSKNGQSTIVPLKSH--AKIGQATQMSPKDVQTLKRMY 239
            |::.||..|||.|||||.....|:||::||....||  |.:|:|:..|..|::.:.|.|
 Worm   205 GLSYYGEHYDYSSIMHYEANEGSRNGKNTIEAKNSHFTAIMGKASDFSTSDLRRVNRAY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 65/187 (35%)
ZnMc_astacin_like 58..239 CDD:239807 64/185 (35%)
nas-1NP_499768.2 Astacin 79..266 CDD:279708 66/189 (35%)
ZnMc_astacin_like 82..263 CDD:239807 64/185 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6774
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.