DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and nas-13

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_510549.3 Gene:nas-13 / 185492 WormBaseID:WBGene00003532 Length:450 Species:Caenorhabditis elegans


Alignment Length:243 Identity:76/243 - (31%)
Similarity:119/243 - (48%) Gaps:30/243 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QEDDIILISEQLQY----FEGNLEGRVVKSWS----------------------EYY--WKGRTL 61
            :|:|...:::...|    |||::....:.|.|                      :.|  |:...:
 Worm    60 RENDQWFVNDSAMYNPLRFEGDIANSGLNSRSINTFFGDSPLFGIFGVQRNAVRQTYLKWEQARI 124

  Fly    62 VYSYAGGFSSLDIASIESAMAEISSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVGYLGRADQTL 126
            .|:.:..:||...:.|..|:.|...|||:.|..........:.|..: .||:|.||.:| ..|.:
 Worm   125 PYTISSQYSSYSRSKIAEAIEEYRKKTCIDFSPKSAGDLDYIHIVPD-DGCYSLVGRIG-GKQPV 187

  Fly   127 NLGSGCMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGY 191
            :||.||:....|.|||:||:||||..|...||:||:|...|:.:|.:..|.:...|.:.:.|..|
 Worm   188 SLGDGCIQKGIIIHELMHAVGFFHEQSRADRDEYVKINWSNVEAGLQDQFDKYSLNMIDHLGTKY 252

  Fly   192 DYDSIMHYGPFAFSKNGQSTIVPLKSHAKIGQATQMSPKDVQTLKRMY 239
            ||.|:|||.|.||||||:.||.|::.:.:|||....|..|:..:..:|
 Worm   253 DYGSVMHYAPTAFSKNGKPTIEPIEKNVEIGQRAGFSENDIYKINMLY 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 66/182 (36%)
ZnMc_astacin_like 58..239 CDD:239807 65/180 (36%)
nas-13NP_510549.3 Astacin 118..304 CDD:279708 67/185 (36%)
ZnMc_astacin_like 122..300 CDD:239807 65/179 (36%)
ShK 367..404 CDD:279838
ShK 414..450 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.