DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and nas-24

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_506409.2 Gene:nas-24 / 184744 WormBaseID:WBGene00003543 Length:396 Species:Caenorhabditis elegans


Alignment Length:208 Identity:52/208 - (25%)
Similarity:93/208 - (44%) Gaps:37/208 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QYFEGNLEG-----RVVKSWSEY--YWKGRTLVYSYAGGFSSLDIASIESAMAEISSKTCVKFRR 94
            ::.|.::||     ||.:.:...  .|.|.|:.|.||...:|:. ..::||:|.|::.||:||..
 Worm    24 RFNEHDIEGGDSYKRVKREFERLGSKWLGGTINYYYADNNNSVK-EKVKSAIAYIANHTCIKFNE 87

  Fly    95 TEYKREPQVVIQKEGSGCWSYVGYLGRADQT---LNLGSG-CMSNRTIQHELLHALGFFHTHSDP 155
            .....:...:...|.|.|.|.:|..|....:   |::.:| |.:..:|.||..|:||.:|.|:.|
 Worm    88 DPTHWQRLKIFTSELSHCRSTIGAPGTRSGSAGELSMETGWCANIGSIVHEFSHSLGRYHEHTRP 152

  Fly   156 QRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKNGQSTIVPLKSHAK 220
            .||..:::.:.:..:       |.|..|:|.....:::.|||.|                  |:.
 Worm   153 DRDNSLKVTSTDYEA-------RPRPWGMTTMYGPFEHGSIMMY------------------HSS 192

  Fly   221 IGQATQMSPKDVQ 233
            .....:|.|.|::
 Worm   193 NYGVGKMEPYDME 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 47/182 (26%)
ZnMc_astacin_like 58..239 CDD:239807 46/180 (26%)
nas-24NP_506409.2 Astacin 49..231 CDD:279708 47/183 (26%)
ZnMc 52..227 CDD:294052 46/180 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.