DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and nas-12

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_501871.2 Gene:nas-12 / 182848 WormBaseID:WBGene00003531 Length:384 Species:Caenorhabditis elegans


Alignment Length:223 Identity:63/223 - (28%)
Similarity:109/223 - (48%) Gaps:16/223 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DIILISEQLQYFEG------NLEGRVVKSWSEYYWKGRTLVYSYAGGFSSLDIASIESAMAEISS 86
            |::|...||..:|.      ::.|..:|..|...|....:.|..:..:|......:.|::.....
 Worm    49 DMLLTPAQLIRYENSKDSDLSIRGVSIKGSSMNRWSNNIVPYVISPQYSPAQKQILVSSLRYFER 113

  Fly    87 KTCVKFRRTEYKREPQVVIQKEGSGCWSYVGYLGRADQTLNLGSGCMSNRTIQHELLHALGFFHT 151
            .:|.||.....:.:...::..:  ||:||||.:| ..|||:|.:.|:::..|.||::||:||.|.
 Worm   114 VSCFKFVERTTQNDYLFIVPLD--GCYSYVGKIG-GRQTLSLAADCIADYIIWHEMMHAIGFEHE 175

  Fly   152 HSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKNGQ------S 210
            |..|.||.::|:...|:..|...||.:|:.:.| .|...||:.|||||..:||.:...      :
 Worm   176 HQRPDRDSFIRVDYANVIPGQMINFDKLKTSHV-EYPDIYDFKSIMHYDGYAFGRVDTARRVRLA 239

  Fly   211 TIVPLKSHAKIGQATQMSPKDVQTLKRM 238
            |:.|||....:....:.:..|::.|.|:
 Worm   240 TMTPLKPGVTLEDNMKFTATDIEKLNRL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 55/189 (29%)
ZnMc_astacin_like 58..239 CDD:239807 54/187 (29%)
nas-12NP_501871.2 Astacin 81..272 CDD:279708 55/191 (29%)
ZnMc_astacin_like 85..267 CDD:239807 53/185 (29%)
ShK 286..325 CDD:279838
ShK 347..384 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.