DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and nas-7

DIOPT Version :10

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_495552.2 Gene:nas-7 / 182368 WormBaseID:WBGene00003526 Length:382 Species:Caenorhabditis elegans


Alignment Length:253 Identity:76/253 - (30%)
Similarity:119/253 - (47%) Gaps:40/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KLQEDDIILISE-----QLQYFE-------GNLEGRVVK----------------------SWSE 53
            ::|:|::::||:     .|:.||       ..|.|:.:.                      |.:.
 Worm    22 RVQDDEMLVISDSTDSLNLEDFEFADKLTREELFGKHIPVEVVNDFKSDIRLPRRHKRNGVSRAA 86

  Fly    54 YYWKGRTLVYSYAGGFSSLDIASIESAMAEISSKTCVKF--RRTEYKREPQVVIQKEGSGCWSYV 116
            ..|....:.|:.:..:|..:.|.:..|:.:...|||::|  |:|   .||..:...:..||:|.|
 Worm    87 KLWPNARIPYAISPHYSPHERALLAKAVKQYHEKTCIRFVPRQT---GEPDYLFIGKVDGCFSEV 148

  Fly   117 GYLGRADQTLNLGSGCMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRA 181
            |..... |.|:|.:|||...||.||::|.:||:|.|....||.::.|...||..|....|.::..
 Worm   149 GRTSGV-QVLSLDNGCMEYATIIHEMMHVVGFYHEHERWDRDNFIDIIWQNIDRGALDQFGKVDL 212

  Fly   182 NGVTNYGFGYDYDSIMHYGPFAFSKNGQSTIVPLKSHAKIGQATQMSPKDVQTLKRMY 239
            :..:.||..|||.||:||...||||||..|::|....|.||.|...|..|:..:.|||
 Worm   213 SKTSYYGQPYDYKSILHYDSLAFSKNGFPTMLPKVKSATIGNARDFSDVDISKINRMY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 ZnMc_astacin_like 58..239 CDD:239807 63/182 (35%)
nas-7NP_495552.2 Astacin 87..274 CDD:426242 66/188 (35%)
ShK 347..382 CDD:426319
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.