DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and nas-6

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001040902.1 Gene:nas-6 / 181796 WormBaseID:WBGene00003525 Length:344 Species:Caenorhabditis elegans


Alignment Length:218 Identity:70/218 - (32%)
Similarity:114/218 - (52%) Gaps:21/218 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FEGNLEG---------------RVVKSWSEYYWKGRTLVYSYAGGFSSLDIASIESAMAEISSKT 88
            |:|:::|               ..:|: .:..|:|..:.|.....||..:|..:|.|.......|
 Worm    50 FQGDIDGVDPNLLKLPEGPVLFNALKN-KQLTWEGGVIPYEMDTAFSPNEIKILEKAFDSYRRTT 113

  Fly    89 CVKFRRTEYKREPQVVIQKEGSGCWSYVGYLGRADQTLNLGSGCMSNRTIQHELLHALGFFHTHS 153
            |::|.:.|.:.:...::  :|.||:|.||..| ..|.::||.||..:..|.|||:|::||:|.||
 Worm   114 CIRFEKREGQTDYLNIV--KGYGCYSQVGRTG-GKQEISLGRGCFFHEIIVHELMHSVGFWHEHS 175

  Fly   154 DPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKNGQSTIVPLKS- 217
            ...||.:::|..|||..|.:..|.::.|......|..|||.|||||...|||:||::||..::: 
 Worm   176 RADRDDHIKINWDNILPGMKSQFDKISAVLQDLQGENYDYKSIMHYDSTAFSRNGRNTIETVENG 240

  Fly   218 -HAKIGQATQMSPKDVQTLKRMY 239
             ...||.|..:||.|:..:.::|
 Worm   241 FTQVIGTAMDLSPLDIVKINKLY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 65/184 (35%)
ZnMc_astacin_like 58..239 CDD:239807 64/182 (35%)
nas-6NP_001040902.1 Astacin 80..265 CDD:279708 66/187 (35%)
ZnMc_astacin_like 83..263 CDD:239807 64/182 (35%)
ShK 299..334 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166526
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.