DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and hch-1

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_510440.1 Gene:hch-1 / 181564 WormBaseID:WBGene00001828 Length:605 Species:Caenorhabditis elegans


Alignment Length:247 Identity:74/247 - (29%)
Similarity:117/247 - (47%) Gaps:38/247 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LQEDDIILISEQLQYFEGNLEGRVVKSWSEYYW-------------KGRTLVYS----------- 64
            |.|.|::|..||:..        ::|:..:.||             :|:..:.|           
 Worm    83 LFEGDMVLTDEQMDL--------IIKNVRDQYWARKSSTNEFLYAIRGKRSMTSFLSERWSFPVP 139

  Fly    65 -YAGGFSSLDIASIESAMAEISSKTCVKFRR-TEYKREPQVVIQK--EGSGCWSYVGYLGRADQT 125
             |....|.::..::.:.:|:...:||.:|.| ..|....:....:  .|:||:|.:|.:.|..|.
 Worm   140 YYIDTSSGVNTNAVLAGVAKWEQETCARFTRLNSYSSSSRQNALRFISGNGCYSNIGKVSRFPQD 204

  Fly   126 LNLGSGCMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFG 190
            :::|.||.|..|:.||:.|||||:|..:...||.||.|.|.||:..:...|.:..|:.:.:||.|
 Worm   205 VSIGWGCTSLGTVCHEIGHALGFYHEQARYDRDDYVSILTQNIQDMYLSQFTKQSASSMVDYGVG 269

  Fly   191 YDYDSIMHYGPFAFSKNGQSTIVPLKSH--AKIGQATQMSPKDVQTLKRMYC 240
            |||.|:|||...|||..|.:||.....:  |.|||....|..||:.:...||
 Worm   270 YDYGSVMHYDQAAFSSTGGNTIATRDPNFQATIGQRVAPSFADVKRINFAYC 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 64/212 (30%)
ZnMc_astacin_like 58..239 CDD:239807 63/197 (32%)
hch-1NP_510440.1 Astacin 132..323 CDD:279708 63/190 (33%)
ZnMc_astacin_like 135..320 CDD:239807 61/184 (33%)
CUB 386..466 CDD:214483
TSP1 533..565 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.