DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and nas-11

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001024789.1 Gene:nas-11 / 180938 WormBaseID:WBGene00003530 Length:579 Species:Caenorhabditis elegans


Alignment Length:214 Identity:69/214 - (32%)
Similarity:102/214 - (47%) Gaps:21/214 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 YFEGNLEGRVVKSWSEYYWKGRTLVYSYAGGFSSLDIASIESAMAEISSKTCVKFRRTEYKREP- 101
            ||||||    :|.|.    ....:.|........||...:.:|:.||...||::|:  |....| 
 Worm   332 YFEGNL----IKKWD----PSSPIRYVLDSSLEDLDKNDVRAAIYEIEKNTCIRFK--ELSSPPT 386

  Fly   102 --QVVIQKEGSGCWSYVGYLGRAD--QTLNLGSGCMSNRTIQ-HELLHALGFFHTHSDPQRDKYV 161
              .:|..|..|..:..:.|:||||  ..:.|..||.:|:.:. ||.:||||..|.|....||:::
 Worm   387 GSHIVYYKVDSPTFCGLSYVGRADPANPVYLSFGCDNNKGVAIHETMHALGVAHQHLRNDRDQFI 451

  Fly   162 RIQTDNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKN-GQSTIVPLKSHA----KI 221
            .|...||.......|..:.:...|:||..|.|||||||..:..::| ...|:.|..:.|    .:
 Worm   452 TINWSNIDPQQYDAFVVVDSKLYTSYGVKYAYDSIMHYNGYTAAQNIAIPTMNPKTNSAVNLKVL 516

  Fly   222 GQATQMSPKDVQTLKRMYC 240
            ||..:|...|::.||:|||
 Worm   517 GQRQKMGTTDIELLKKMYC 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 58/193 (30%)
ZnMc_astacin_like 58..239 CDD:239807 58/191 (30%)
nas-11NP_001024789.1 Astacin 339..537 CDD:279708 63/203 (31%)
ZnMc_astacin_like 346..534 CDD:239807 58/189 (31%)
ShK 538..575 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.