DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and nas-9

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_741532.1 Gene:nas-9 / 178875 WormBaseID:WBGene00003528 Length:546 Species:Caenorhabditis elegans


Alignment Length:247 Identity:74/247 - (29%)
Similarity:108/247 - (43%) Gaps:38/247 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DIILISEQLQYFEGNL---------------EGRV-----------VKSWSEYYWKGRTLVYSYA 66
            |::|...|..:....|               .|||           |:.|.  .||  .:.|:..
 Worm   264 DVLLTEHQANFLLNELGEAGRGADVGAGGGGGGRVPRSGVFFQESAVQKWD--IWK--PIQYTLD 324

  Fly    67 GGFSSLDIASIESAMAEISSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVGYLGRAD--QTLNLG 129
            ......|...|..|:.|||..||:.||.....:...:...|..|..:..:.|:||.|  ..:.|.
 Worm   325 DSLEESDKKDIRDALHEISINTCILFRYNATPKGYHLNYMKVDSTTFCGLSYVGRTDPANPIYLS 389

  Fly   130 SGCMSNRTI-QHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGYDY 193
            ..|..||.: .||.:||||..|.|....||||::|...||...|...|....|...|:||..|.|
 Worm   390 FQCGDNRGVAMHETMHALGVSHQHLRLDRDKYIKIDWSNIDPQHYDTFAISDAKLYTSYGTKYAY 454

  Fly   194 DSIMHYGPFAFSKN-GQSTIVPL----KSHAKIGQATQMSPKDVQTLKRMYC 240
            ||||||..:..:|: .:.|::||    ::..|:||..:::..|::.||:|||
 Worm   455 DSIMHYNAYLGAKDPNKPTMIPLVNPQENTPKLGQRAKLTRGDIRLLKKMYC 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 62/190 (33%)
ZnMc_astacin_like 58..239 CDD:239807 60/188 (32%)
nas-9NP_741532.1 Astacin 311..505 CDD:279708 63/197 (32%)
ZnMc_astacin_like 316..505 CDD:239807 62/190 (33%)
ShKT 510..546 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.