DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and dpy-31

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001022731.1 Gene:dpy-31 / 176014 WormBaseID:WBGene00006592 Length:592 Species:Caenorhabditis elegans


Alignment Length:237 Identity:75/237 - (31%)
Similarity:116/237 - (48%) Gaps:26/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KLQEDDIILISEQLQ--YFEGNLEGRV----------VKSWSEYYWKGRTLVYSYAGGFSSLDIA 75
            |..:.||:|..||.:  |.:...||:.          ::.|.    ..|.::|::.|..:..:..
 Worm    96 KFFQGDIVLYPEQAKALYEQALTEGKTRVKRKFIGSNLRRWD----ASRPIIYAFDGSHTQREQR 156

  Fly    76 SIESAMAEISSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVGY--LGRADQTLNLGSGCMSNRTI 138
            .||.|:....:.||:.|:|.:.......::..:..||.|.||.  ||. :|.::|...|:....|
 Worm   157 IIELALEHWHNITCLNFQRNDQANSGNRIVFTDVDGCASNVGRHPLGE-EQLVSLAPECIRLGVI 220

  Fly   139 QHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMHYGPFA 203
            .||:.|||||:|..|.|.||:||.::.:||....:..|.:...:.|.|.|..|||.|||||...|
 Worm   221 AHEVAHALGFWHEQSRPDRDQYVTVRWENIDKDSKGQFLKEDPDDVDNAGVPYDYGSIMHYRSKA 285

  Fly   204 FSKNGQ----STIVPLKSHAK-IGQATQMSPKDVQTLKRMYC 240
            |||...    ||.|  ..:.| |||..|:|..|::.:.::||
 Worm   286 FSKFDDLYTISTYV--TDYQKTIGQRDQLSFNDIRLMNKIYC 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 63/189 (33%)
ZnMc_astacin_like 58..239 CDD:239807 63/187 (34%)
dpy-31NP_001022731.1 Astacin 134..327 CDD:279708 66/199 (33%)
ZnMc_astacin_like 139..324 CDD:239807 63/187 (34%)
CUB 383..483 CDD:214483
TSP1 493..539 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.