DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and toh-1

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_497769.3 Gene:toh-1 / 175491 WormBaseID:WBGene00006591 Length:414 Species:Caenorhabditis elegans


Alignment Length:262 Identity:70/262 - (26%)
Similarity:115/262 - (43%) Gaps:32/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LALAVIFGLGSSANGRPSIKLQEDDI-ILISEQLQYF---------EGNLEGRVVKSWSEYYWKG 58
            ||...:..:|.:|.|..|...:...: ::.|::..:|         :.:...|.|.:...|.|..
 Worm     9 LAPLALVAIGEAAFGNSSKIFEIPGLEVMASDKYPHFTTIETVSRTKVHRHRREVIAGQIYDWNS 73

  Fly    59 RTLVYSYAGG---FSSLDIASIESAMAEISSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVGYLG 120
            ..:.:...||   |.||    |...:......||::|:..:..|:....:.::|..|  :..|:|
 Worm    74 YEIPFQIWGGDYNFQSL----IRRGIRMWEDSTCLRFKENQQSRDAIRYVLEKGDSC--FTEYIG 132

  Fly   121 R--ADQTLNLGSGCMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNF----QRL 179
            |  ..|.:.:||.|.....:.||..|||||:|||..|.||:::.|...|:......:|    ..|
 Worm   133 RNGGHQDIIIGSECAEEYVVAHETGHALGFWHTHQRPDRDRHISINWKNVMEEATASFMPFRSML 197

  Fly   180 RANGVTNYG---FGYDYDSIMHYGPFAFS-KNGQSTIVP--LKSHAKIGQATQMSPKDVQTLKRM 238
            :|.|:....   ..|||.|:|||...|.: |....||||  ||....:| ..:|:..|.:.:..:
 Worm   198 QAFGIRQVSPRRVPYDYGSLMHYHAVAHAVKVSDFTIVPKELKYVTTMG-TEKMAFLDAKVINDI 261

  Fly   239 YC 240
            ||
 Worm   262 YC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 57/197 (29%)
ZnMc_astacin_like 58..239 CDD:239807 56/195 (29%)
toh-1NP_497769.3 Astacin 71..265 CDD:279708 59/200 (30%)
ZnMc_astacin_like 73..262 CDD:239807 56/195 (29%)
CUB 320..410 CDD:214483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.