DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and nas-36

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_492109.2 Gene:nas-36 / 172506 WormBaseID:WBGene00003552 Length:617 Species:Caenorhabditis elegans


Alignment Length:237 Identity:72/237 - (30%)
Similarity:108/237 - (45%) Gaps:18/237 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NGRPSIKLQEDDIILISEQ----LQYFEGNLEGRVVKSW---SEYYWKGRTLVYSYAGGFSSLDI 74
            |.:.|..|.|.||.|...|    |:....:...|:.:|:   ....||...:.|.:   ..|:|.
 Worm    90 NKKVSPFLFEGDIFLSRRQAVDILKALSKDKTKRLRRSFVSDKTATWKTMPIKYRF---HESIDF 151

  Fly    75 ASIESAMAEI---SSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVGYLGRADQTLNLGSGCMSNR 136
            .:|...:|.|   ...||:.|.......:...:....|.||:|.:|..| ..|.:::|..|:...
 Worm   152 YTISQIIAAIRFWEDSTCITFENVSDSPDGDYIEFFSGQGCYSMIGRNG-GRQGISIGESCVKMG 215

  Fly   137 TIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMHYGP 201
            .|:||:.||||.:|..|.|....||.|:.|.|...:..:|.: |.:.:...|..||..|:||||.
 Worm   216 VIEHEIGHALGLWHEQSRPDALGYVTIERDFILPSYISDFLQ-RDDEIDTLGIPYDLGSVMHYGS 279

  Fly   202 FAFSKNGQS-TIVPLKS--HAKIGQATQMSPKDVQTLKRMYC 240
            .|||.:.:| |:|...|  ...|||..::|..||.|:...||
 Worm   280 TAFSVDQKSKTVVTRDSLYQQTIGQREKLSFYDVATINTAYC 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 59/188 (31%)
ZnMc_astacin_like 58..239 CDD:239807 57/186 (31%)
nas-36NP_492109.2 Astacin 134..323 CDD:279708 61/193 (32%)
ZnMc_astacin_like 140..320 CDD:239807 57/184 (31%)
CUB 380..478 CDD:214483
TSP1 510..556 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.