DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and astl2d.4

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_004913426.2 Gene:astl2d.4 / 101734297 XenbaseID:XB-GENE-22069748 Length:537 Species:Xenopus tropicalis


Alignment Length:260 Identity:85/260 - (32%)
Similarity:123/260 - (47%) Gaps:42/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IFGLG-------SSANGRPSIKLQEDDIILISE-----QLQYFEGNLEGRVVKS--------WSE 53
            ||||.       .|..|:.:|...:|....::|     :::..:|::...|.:|        |.:
 Frog    57 IFGLDDVFSRLTESNTGQNAIFGPDDGFSRLTEANKGSRVRRVQGDIAIGVSRSALNCTNCLWPK 121

  Fly    54 YYWKGRTLV-YSYAGGFSSLDIASIESAMAEISSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVG 117
              ..|...| |:....:|:.::.:|.:||...::.|||:|  ..|..|...|..|..:|||||:|
 Frog   122 --TNGTVYVPYTLDDEYSNNEVNTITAAMQVYATLTCVQF--VPYTDEDDYVAIKSANGCWSYMG 182

  Fly   118 YLGRADQTLNLGSG-CMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRA 181
            ..|.| |.:::..| |.|..|..|||.|||||.|..|...||.||.|....|..|...||:.:..
 Frog   183 RQGGA-QVVSVEKGYCTSEGTTMHELNHALGFVHEQSRSDRDNYVNIMYQYISPGDIVNFEIMNT 246

  Fly   182 NGVTNYGFGYDYDSIMHYGPFAFSK-NGQSTIVPLKSHAK------IGQATQMSPKDVQTLKRMY 239
            |.:...   |||.|||||..:|||. .||:|||     ||      ||..:.|:..|:..:.|:|
 Frog   247 NNLNTI---YDYRSIMHYPAWAFSNTTGQNTIV-----AKPNPNIIIGAGSTMTSLDIIKINRLY 303

  Fly   240  239
             Frog   304  303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 71/191 (37%)
ZnMc_astacin_like 58..239 CDD:239807 71/189 (38%)
astl2d.4XP_004913426.2 ZnMc_hatching_enzyme 123..305 CDD:239810 72/192 (38%)
CUB 308..417 CDD:395345
CUB 422..533 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.