DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and accs

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_017948750.2 Gene:accs / 100495810 XenbaseID:XB-GENE-989873 Length:492 Species:Xenopus tropicalis


Alignment Length:233 Identity:80/233 - (34%)
Similarity:112/233 - (48%) Gaps:26/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SANGRPSIKLQEDDIILISEQLQYFEGNLEGRVVKSWSEYYW----KGRTLV-YSYAGGFSSLDI 74
            |.||... ||.:.||.:.:           ||.....:...|    .|...| |..:..:|..:.
 Frog    42 SNNGTVK-KLWQGDIAIET-----------GRSATKCTSCLWPKSADGTVRVPYRLSADYSDNEK 94

  Fly    75 ASIESAMAEISSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVGYLGRADQTLNL-GSGCMSNRTI 138
            :||..|:.|.::.|||.|  .|...|...:.....|||||.:|..|.| |||:| .|||::...|
 Frog    95 SSIRDALLEFNTLTCVHF--VERSTEEDFLDIVSDSGCWSSIGRTGGA-QTLSLMSSGCLAKGII 156

  Fly   139 QHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMHYGPFA 203
            |||:.|||||:|..|...||.|:.:....|......:|:.:..:   |....|||.|:||||.:|
 Frog   157 QHEVDHALGFYHEQSRSDRDTYIDVLWQYICESDWGSFEMVDTD---NLDLPYDYSSVMHYGWYA 218

  Fly   204 FSK-NGQSTIVPLKS-HAKIGQATQMSPKDVQTLKRMY 239
            ||. :||.::.|... .|.|||...:||.||..:|.:|
 Frog   219 FSNTSGQPSLRPKPDPTANIGQRYGLSPLDVSKVKELY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 70/190 (37%)
ZnMc_astacin_like 58..239 CDD:239807 69/184 (38%)
accsXP_017948750.2 ZnMc 76..258 CDD:412141 70/187 (37%)
CUB 261..374 CDD:238001
CUB 377..488 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.