DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and astl2d.5

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_031756347.1 Gene:astl2d.5 / 100495579 XenbaseID:XB-GENE-22069752 Length:497 Species:Xenopus tropicalis


Alignment Length:249 Identity:84/249 - (33%)
Similarity:117/249 - (46%) Gaps:42/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FGLGS------SAN-GRPSIKLQEDDIILISEQLQYFEGNLEGRVVKSWSEYYWK---GRTLV-Y 63
            ||.|.      .|| |....::|||..:.:|            |...:::|..|:   |...| |
 Frog    38 FGQGHVFSRILKANQGNRVPRVQEDIAVGVS------------RSAITYTECLWQKTNGTVYVPY 90

  Fly    64 SYAGGFSSLDIASIESAMAEISSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVGYLGRADQTLNL 128
            :....:|:.::.::.|||...::.|||:|  ..|..|...|....|.|||||:| ..|..|.:::
 Frog    91 TLDDKYSNSEVNTMTSAMEVYATLTCVQF--VPYTDEDDYVNITSGDGCWSYMG-RQRGAQVVSV 152

  Fly   129 GSG-CMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGYD 192
            ..| |.|..|..|||.|||||.|..|...||.||.|....|..|....|:::.:|   |.|..||
 Frog   153 EKGYCTSEGTTMHELNHALGFVHEQSRSDRDNYVNIMYQYISPGDVAEFKKMESN---NLGTTYD 214

  Fly   193 YDSIMHYGPFAFSK-NGQSTIVPLKSHAK------IGQATQMSPKDVQTLKRMY 239
            |.|:|||..:|||. .||:|||     ||      ||....|:..|:..:.|:|
 Frog   215 YRSVMHYPAWAFSNTTGQNTIV-----AKPNPNIIIGAGNTMTSLDIIKINRLY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 71/194 (37%)
ZnMc_astacin_like 58..239 CDD:239807 70/189 (37%)
astl2d.5XP_031756347.1 ZnMc 83..265 CDD:412141 71/192 (37%)
CUB 268..377 CDD:395345
CUB 382..493 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.