DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and astl3b.4

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_031746772.1 Gene:astl3b.4 / 100491283 XenbaseID:XB-GENE-22069691 Length:533 Species:Xenopus tropicalis


Alignment Length:238 Identity:94/238 - (39%)
Similarity:121/238 - (50%) Gaps:24/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IFGLGSSANGRPSIKLQEDDIILISEQLQYFEGNLEGRVVKSWSEYYW----KGRTLV-YSYAGG 68
            :|...|..|...|:...|.||:           ..|||...:.:|..|    .|..:| |:::..
 Frog    78 VFTQISKVNRGISVPTYEGDIL-----------RPEGRSAMNCTECLWPKSTDGTVIVPYNFSSN 131

  Fly    69 FSSLDIASIESAMAEISSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVGYLGRADQTLNLGS-GC 132
            :|:..:|..:|||.|..|.|||:|  .....|...:....||||.|::|.||.| ||:.|.| ||
 Frog   132 YSADQLALFKSAMQEYESLTCVRF--VPRANETAFLNIISGSGCVSFLGKLGGA-QTVQLASYGC 193

  Fly   133 MSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGYDYDSIM 197
            :....|||||.|||||:|..|...||.||.|.|:||..|:|.||.:...|   |.|..|||.|:|
 Frog   194 IYRGIIQHELNHALGFYHEQSRSDRDDYVTIHTENILPGYEGNFNKANTN---NLGLEYDYSSVM 255

  Fly   198 HYGPFAFSKNGQSTIVPLKS-HAKIGQATQMSPKDVQTLKRMY 239
            ||...||||||..||||... ...|||...:|..||..:.|:|
 Frog   256 HYPGDAFSKNGNLTIVPKPDPTVPIGQRDGLSILDVSKINRLY 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 82/189 (43%)
ZnMc_astacin_like 58..239 CDD:239807 81/183 (44%)
astl3b.4XP_031746772.1 ZnMc_hatching_enzyme 119..300 CDD:239810 82/186 (44%)
CUB 304..412 CDD:238001
CUB 417..525 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.