DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and LOC100488711

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_031756326.1 Gene:LOC100488711 / 100488711 -ID:- Length:497 Species:Xenopus tropicalis


Alignment Length:246 Identity:82/246 - (33%)
Similarity:117/246 - (47%) Gaps:36/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FGLG---------SSANGRPSIKLQEDDIILISEQLQYFEGNLEGRVVKSWSEYYWKGRT----L 61
            ||.|         :..||.|  ::|||..:.:|            |...:.:|..|:...    :
 Frog    37 FGQGDVFSRILKANQGNGVP--RVQEDIAVGVS------------RSAITSTECLWQKTNETVYV 87

  Fly    62 VYSYAGGFSSLDIASIESAMAEISSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVGYLGRADQTL 126
            .|:....:|:.::.::.|||...::.|||:|  ..|..|...|....|.|||||:|..|.| |.:
 Frog    88 PYTLDSKYSNSEVNTMTSAMEVYATLTCVQF--VPYTDEDDYVNITSGDGCWSYMGRQGGA-QVV 149

  Fly   127 NLGSG-CMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFG 190
            ::..| |.|..|..|||.|||||.|.||...||.||.|....|..|...||:.:..|.:...   
 Frog   150 SVEKGYCTSEGTTMHELNHALGFVHEHSRSDRDNYVNIMYQYISPGDIVNFEIMNTNNLNTI--- 211

  Fly   191 YDYDSIMHYGPFAFSK-NGQSTIV-PLKSHAKIGQATQMSPKDVQTLKRMY 239
            |||.|||||..:|||. .|::||| .|..:..||..:.|:..|:..:.|:|
 Frog   212 YDYRSIMHYPAWAFSNTTGKNTIVAKLNPNIIIGAGSTMTSLDIIKINRLY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 69/189 (37%)
ZnMc_astacin_like 58..239 CDD:239807 68/187 (36%)
LOC100488711XP_031756326.1 ZnMc 82..264 CDD:412141 69/187 (37%)
CUB 276..373 CDD:214483
CUB 378..489 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.