DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and LOC100003133

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_001342763.2 Gene:LOC100003133 / 100003133 -ID:- Length:276 Species:Danio rerio


Alignment Length:277 Identity:86/277 - (31%)
Similarity:133/277 - (48%) Gaps:44/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHYLALAVIF--------------GLGSSANGRPSIKLQE-----DDIILISEQLQYF------- 39
            |.:..|.|:|              ..|:......|..::|     |.||.:::....|       
Zfish     1 MEFTLLIVLFLAGTCLSLPSQVSPNFGARRQRSYSEDIEENQTAMDRIIDVNDYQGVFSVDGTNL 65

  Fly    40 -EGNL--EGRVVKS-------WSEYYWKGRTLVYSYAGGFSSLDIASIESAMAEISSKTCVKFRR 94
             ||::  .||..|:       |::.......:.||.:..:...|:.:|:..|..|...|||:|..
Zfish    66 REGDIAVSGRSQKNCFARSCLWTKSVDGNVYIAYSLSHAYDDADVKNIKEGMELIEQDTCVRFVP 130

  Fly    95 TEYKREPQVVIQKEGSGCWSYVGYLGRADQTLNLGS-GCMSNRTIQHELLHALGFFHTHSDPQRD 158
            ..::|: .:.||.: :|||||:|..| ..||::|.| .|..:....|||:|||||.|..|...||
Zfish   131 RTHQRD-YLDIQPK-TGCWSYLGARG-GRQTISLQSPDCTGSGVTVHELMHALGFVHEQSRADRD 192

  Fly   159 KYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKNGQSTIVPLKS-HAKIG 222
            |||.|...||......||::.:.|   |....|||.|:||:|.:|||::|:.||||.:: :.|||
Zfish   193 KYVTIMWSNIWKDRLRNFEKFKTN---NLDTPYDYSSVMHFGKYAFSEDGEPTIVPKRNWNVKIG 254

  Fly   223 QATQMSPKDVQTLKRMY 239
            |....|..|:..:.::|
Zfish   255 QRLGPSDLDIMKINKLY 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 68/184 (37%)
ZnMc_astacin_like 58..239 CDD:239807 68/182 (37%)
LOC100003133XP_001342763.2 ZnMc_hatching_enzyme 92..273 CDD:239810 69/186 (37%)
Astacin 97..274 CDD:279708 69/181 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.