DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and Bmp1

DIOPT Version :10

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_112613.1 Gene:Bmp1 / 83470 RGDID:620739 Length:990 Species:Rattus norvegicus


Alignment Length:226 Identity:80/226 - (35%)
Similarity:108/226 - (47%) Gaps:19/226 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PSGSSRNIWRNE-------TYR----WPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKE 95
            |...||..||:.       |.|    ||:.:|.:.|........|.....|::..|..:|:||.|
  Rat   108 PQRGSRGRWRSRPRSRRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLE 172

  Fly    96 ATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAA 160
             .||:..|:..|....||.||:|....    ..|...||..|.:...:|||..|.:||:|:.:..
  Rat   173 -RTDEDSYIVFTYRPCGCCSYVGRRGG----GPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRP 232

  Fly   161 DRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKN-GERTILALEE-- 222
            |||.:|.||.|||..|.|:||.|...:.|...||.||:.|:|||....||:. ...||:...|  
  Rat   233 DRDRHVSIVRENIQPGQEYNFLKMEVQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVN 297

  Fly   223 GKEDVIGQRLELSETDIRKLNAIYKCPTVKE 253
            |.:..||||..||:.||.:...:||||...|
  Rat   298 GVKPSIGQRTRLSKGDIAQARKLYKCPACGE 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 ZnMc_astacin_like 59..246 CDD:239807 66/189 (35%)
Bmp1NP_112613.1 ZnMc_BMP1_TLD 125..324 CDD:239808 72/203 (35%)
CUB 326..435 CDD:395345 1/3 (33%)
CUB 439..548 CDD:395345
FXa_inhibition 559..591 CDD:464251
CUB 595..704 CDD:395345
FXa_inhibition 711..746 CDD:464251
CUB 751..860 CDD:395345
CUB 864..977 CDD:395345
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.