DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and LOC797085

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001373298.1 Gene:LOC797085 / 797085 -ID:- Length:285 Species:Danio rerio


Alignment Length:221 Identity:71/221 - (32%)
Similarity:111/221 - (50%) Gaps:24/221 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GYI--EGDMVPSGSSRNIWRNETYRWPNR----IIYYHINSYIDEEHRNHIVSAIQKIESISCLT 92
            ||.  |.|::|. :.||.   ..:.||.:    .:.|.|.|.: |:...||::|::.:...:|:.
Zfish    81 GYALEEEDIIPQ-TDRNA---GNHLWPEKDGEVSVPYSIASGL-EDKTGHILAALKMVSKKTCVK 140

  Fly    93 FKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQ 157
            |...||::.|.  ....:..|.|.:|.....|.:     .:|..| ....|.||.||:||.:|:.
Zfish   141 FHHHTTEEDYL--HFKPDRMCASLVGCAGGEQPI-----LVGPKC-NAGNICHEILHSLGLYHEH 197

  Fly   158 SAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGERTILALEE 222
            |..|||.|:.|:.:||..|.|.||   ..:..|..|.:||..|::|||...||:||..||:..::
Zfish   198 SRPDRDKYITILYDNIMPGKESNF---KVKKGNTLGLEYDLDSILHYGDDCFSRNGNHTIIPKKK 259

  Fly   223 GKEDVIGQRLELSETDIRKLNAIYKC 248
            |.:  ||||..:|..|:.:|..:|.|
Zfish   260 GVK--IGQRTHMSVLDVERLRRLYHC 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 64/198 (32%)
ZnMc_astacin_like 59..246 CDD:239807 60/190 (32%)
LOC797085NP_001373298.1 ZnMc_astacin_like 111..281 CDD:239807 60/183 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.