DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and he1.3

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001091658.1 Gene:he1.3 / 792176 ZFINID:ZDB-GENE-040518-1 Length:271 Species:Danio rerio


Alignment Length:270 Identity:80/270 - (29%)
Similarity:130/270 - (48%) Gaps:41/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLLVVVNVAWAAP------------------SIRIETDPELTAGYIEGDMV-PSGSSRNIWRN 52
            |.:.|::|.::.|||                  :..:||:...:...|||||: |...:..:..|
Zfish     7 LSIQLLLVGISLAAPVGEYDNSNGIETPQNVDITTLLETNKGSSRRLIEGDMLYPQTRNALVCGN 71

  Fly    53 ETYRW-PNRIIYYHINSYIDEEHRNHIVSAIQK----IESISCLTF--KEATTDQKYYVNVTSEE 110
            ....| .|...:..:...:..|:....:|.|||    |.:.:|:.|  :.:.||   |:::.:::
Zfish    72 NNCFWKKNSSNFVEVPYIVSSEYSATEISVIQKAMSGIHNKTCIRFVPRISQTD---YISIENQD 133

  Fly   111 GGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITE 175
             |||::||.....|.::|:..    ||.....:.||..|||||:|:...:|||.|:.|..|.|..
Zfish   134 -GCFAFIGKNGGKQLVSLRKK----GCVYHSIVQHELNHALGFYHEHVRSDRDSYITIHWEYIAT 193

  Fly   176 GMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSK-NGERTILALEEGKEDV-IGQRLELSETD 238
            ....||.|   :..|.....|||||:||||..||:. .|:.|:....:  |.| ||:..|:|:.|
Zfish   194 NEIRNFMK---KNTNSQNTTYDYGSIMHYGKTAFTTVKGKETMTPYPD--ETVPIGKAKEMSDID 253

  Fly   239 IRKLNAIYKC 248
            |.::|.:|.|
Zfish   254 ILRINMMYSC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 65/203 (32%)
ZnMc_astacin_like 59..246 CDD:239807 62/194 (32%)
he1.3NP_001091658.1 ZnMc 82..263 CDD:294052 62/193 (32%)
Astacin 86..264 CDD:279708 63/191 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.