DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and c6ast1

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001036784.1 Gene:c6ast1 / 751088 ZFINID:ZDB-GENE-070621-1 Length:260 Species:Danio rerio


Alignment Length:199 Identity:71/199 - (35%)
Similarity:112/199 - (56%) Gaps:15/199 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ETYRWP---NRIIY--YHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGG 112
            ::.:||   |..::  |.|:.....:.::.|....:.:|..:|:.|:..|| |:.|:|: ....|
Zfish    68 QSCKWPLSSNGKVFVPYIISDEYSTQEKDVIFQGFRSLEKSTCVRFRPRTT-QRDYINI-EPNSG 130

  Fly   113 CFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGM 177
            |:|::|.....|.::|.::    ||.:|..:.||.||.|||.|:.:.:|||.:||||.:||..|.
Zfish   131 CYSFVGRRTGGQTVSLDHD----GCIKLNIVQHELLHTLGFHHEHNRSDRDSHVQIVYKNIIPGQ 191

  Fly   178 EFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGERTILALEEGKEDVIGQRLELSETDIRKL 242
            |.||||.   ..|:....|||.||||||.:|||||.|.||:.:.:... .||:...:|..||.::
Zfish   192 ERNFDKI---KTNNLETAYDYSSVMHYGRFAFSKNKEATIVPIPDSGV-TIGRAKRMSSNDILRI 252

  Fly   243 NAIY 246
            |.:|
Zfish   253 NRLY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 71/197 (36%)
ZnMc_astacin_like 59..246 CDD:239807 68/188 (36%)
c6ast1NP_001036784.1 Astacin 71..259 CDD:279708 71/196 (36%)
ZnMc_hatching_enzyme 77..257 CDD:239810 69/190 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.