DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and TLL2

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_036597.1 Gene:TLL2 / 7093 HGNCID:11844 Length:1015 Species:Homo sapiens


Alignment Length:215 Identity:74/215 - (34%)
Similarity:105/215 - (48%) Gaps:12/215 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SRNIWRNETYR----WPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNV 106
            |..:.|..|.|    ||..:|.|.|........|.....|::..|..:|:||.| .||::.::..
Human   144 SPRVRRATTSRTERIWPGGVIPYVIGGNFTGSQRAIFKQAMRHWEKHTCVTFIE-RTDEESFIVF 207

  Fly   107 TSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEE 171
            :....||.||:|....    ..|...||..|.:...:.||..|.:||:|:.:..|||.:|.|:.|
Human   208 SYRTCGCCSYVGRRGG----GPQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRE 268

  Fly   172 NITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKN-GERTILALEE--GKEDVIGQRLE 233
            ||..|.|:||.|.....|:..||.||:.|:|||....||:. ...|||..::  |....||||:.
Human   269 NIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFSRGVFLDTILPRQDDNGVRPTIGQRVR 333

  Fly   234 LSETDIRKLNAIYKCPTVKE 253
            ||:.||.:...:||||...|
Human   334 LSQGDIAQARKLYKCPACGE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 69/201 (34%)
ZnMc_astacin_like 59..246 CDD:239807 63/189 (33%)
TLL2NP_036597.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..130
ZnMc_BMP1_TLD 150..349 CDD:239808 69/203 (34%)
Astacin 157..350 CDD:279708 68/197 (35%)
CUB 351..460 CDD:278839 1/3 (33%)
CUB 464..573 CDD:278839
FXa_inhibition 584..616 CDD:291342
CUB 620..729 CDD:278839
FXa_inhibition 736..771 CDD:291342
CUB 776..885 CDD:278839
CUB 889..1002 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.