DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and TLL1

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_036596.3 Gene:TLL1 / 7092 HGNCID:11843 Length:1013 Species:Homo sapiens


Alignment Length:226 Identity:79/226 - (34%)
Similarity:115/226 - (50%) Gaps:16/226 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AGYIEGDMVPSGSSRNIWRNETYR-WPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEA 96
            :|..|.:.||..::     :.|.| ||..:|.|.|........|.....|::..|..:|:||.| 
Human   137 SGQNEKNRVPRAAT-----SRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFIE- 195

  Fly    97 TTDQKYYVNVTSEEGGCFSYIGYL-NRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAA 160
            .:|::.|:..|....||.||:|.. |..|.::     ||..|.:...:|||..|.:||:|:.:..
Human   196 RSDEESYIVFTYRPCGCCSYVGRRGNGPQAIS-----IGKNCDKFGIVVHELGHVIGFWHEHTRP 255

  Fly   161 DRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKN-GERTILAL--EE 222
            |||::|.|:.|||..|.|:||.|.....||..||:||:.|:|||....||:. ...|||..  :.
Human   256 DRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDN 320

  Fly   223 GKEDVIGQRLELSETDIRKLNAIYKCPTVKE 253
            |....||||..||:.||.:...:|:||...|
Human   321 GIRPAIGQRTRLSKGDIAQARKLYRCPACGE 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 72/199 (36%)
ZnMc_astacin_like 59..246 CDD:239807 67/190 (35%)
TLL1NP_036596.3 ZnMc_BMP1_TLD 148..347 CDD:239808 72/209 (34%)
Astacin 155..348 CDD:279708 72/198 (36%)
CUB 349..458 CDD:278839 1/3 (33%)
CUB 462..571 CDD:278839
FXa_inhibition 582..614 CDD:291342
CUB 618..727 CDD:278839
FXa_inhibition 734..769 CDD:291342
CUB 774..883 CDD:278839
CUB 887..1000 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.