DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and astl2c

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001037864.1 Gene:astl2c / 594901 XenbaseID:XB-GENE-6449741 Length:496 Species:Xenopus tropicalis


Alignment Length:220 Identity:74/220 - (33%)
Similarity:117/220 - (53%) Gaps:17/220 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YIEGDMVPSGSSRNIWRNETYRWP---NRIIY--YHINSYIDEEHRNHIVSAIQKIESISCLTFK 94
            :::|| :....||:....:...||   |.|:.  |.|:|...:...:.|::|:|:..:::|:.| 
 Frog    58 HVQGD-IAHKFSRSAINCKECLWPKDSNGIVNVPYTISSDYSQNEASLIMAAMQEFATLTCVQF- 120

  Fly    95 EATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSA 159
            ...||:..|:.:...: ||:||||.....||::|...    ||.....|.||..|.|||.|:.|.
 Frog   121 IPQTDEDDYIAIQPLD-GCWSYIGVNGGAQQVSLGKG----GCIYYGVIQHELNHVLGFVHEHSR 180

  Fly   160 ADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSK-NGERTILALEEG 223
            :|||:||.|..:.|:......|||   :..::.|.:|||.|||||..|::|. .|:.||:.:...
 Frog   181 SDRDNYVHINYQYISPDNIAFFDK---KDTDNLGLEYDYSSVMHYPGYSYSNTTGKNTIVPIPNA 242

  Fly   224 KEDVIGQRLELSETDIRKLNAIYKC 248
            ... ||||..||..|:.|:|.:|:|
 Frog   243 NVP-IGQRYGLSTLDVSKINRLYQC 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 70/200 (35%)
ZnMc_astacin_like 59..246 CDD:239807 66/189 (35%)
astl2cNP_001037864.1 ZnMc_hatching_enzyme 84..266 CDD:239810 67/191 (35%)
Astacin 89..266 CDD:279708 65/186 (35%)
CUB 270..380 CDD:238001
CUB 383..495 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.