DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and bmp1a

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001035126.1 Gene:bmp1a / 572452 ZFINID:ZDB-GENE-060818-1 Length:986 Species:Danio rerio


Alignment Length:235 Identity:82/235 - (34%)
Similarity:111/235 - (47%) Gaps:20/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SIRIETDPELTAGYIEGDMVPSGSSRNIWRNETYR----WPNRIIYYHINSYIDEEHRNHIVSAI 82
            |:..||....||.        |..|....|..|.|    ||..:|.|.|:.......|.....|:
Zfish    88 SLSNETSVNTTAS--------SRGSHRRRRAATSRPERVWPEGVIPYVISGNFSGSQRAIFRQAM 144

  Fly    83 QKIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEF 147
            :..|..:|:||.|.||::.|.| .|....||.||:|....    ..|...||..|.:...:|||.
Zfish   145 RHWEKHTCVTFIERTTEESYIV-FTYRPCGCCSYVGRRGG----GPQAISIGKNCDKFGIVVHEL 204

  Fly   148 LHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKN 212
            .|.:||:|:.:..|||::|.|:.:||..|.|:||.|.....|:..||.||:.|:|||....||:.
Zfish   205 GHVIGFWHEHTRPDRDEHVSIIRDNIQPGQEYNFLKMEPGEVDSLGEVYDFDSIMHYARNTFSRG 269

  Fly   213 -GERTILALEE--GKEDVIGQRLELSETDIRKLNAIYKCP 249
             ...|||...:  |....||||..||:.||.:...:||||
Zfish   270 IFLDTILPRYDVNGVRPPIGQRTRLSKGDIAQARKLYKCP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 73/202 (36%)
ZnMc_astacin_like 59..246 CDD:239807 66/189 (35%)
bmp1aNP_001035126.1 ZnMc_BMP1_TLD 112..309 CDD:239808 72/201 (36%)
Astacin 117..309 CDD:279708 70/196 (36%)
CUB 311..420 CDD:278839
CUB 424..533 CDD:278839
FXa_inhibition 544..576 CDD:291342
CUB 580..699 CDD:278839
FXa_inhibition 706..741 CDD:291342
CUB 746..855 CDD:278839
CUB 859..972 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.