Sequence 1: | NP_609758.1 | Gene: | CG15253 / 34916 | FlyBaseID: | FBgn0028948 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005155463.1 | Gene: | bmp1b / 559877 | ZFINID: | ZDB-GENE-060818-2 | Length: | 970 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 70/205 - (34%) |
---|---|---|---|
Similarity: | 101/205 - (49%) | Gaps: | 18/205 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 WPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLN 121
Fly 122 RVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTE 186
Fly 187 ETVNDFGEKYDYGSVMHYGPYAFSKNGERTILALE--------EGKEDVIGQRLELSETDIRKLN 243
Fly 244 AIYKCPTVKE 253 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15253 | NP_609758.1 | Astacin | 55..250 | CDD:279708 | 68/200 (34%) |
ZnMc_astacin_like | 59..246 | CDD:239807 | 64/194 (33%) | ||
bmp1b | XP_005155463.1 | ZnMc_BMP1_TLD | 109..303 | CDD:239808 | 67/199 (34%) |
Astacin | 111..303 | CDD:279708 | 67/199 (34%) | ||
CUB | 305..414 | CDD:278839 | 1/3 (33%) | ||
CUB | 418..527 | CDD:278839 | |||
EGF_CA | 530..570 | CDD:214542 | |||
CUB | 575..684 | CDD:278839 | |||
FXa_inhibition | 691..726 | CDD:291342 | |||
CUB | 731..840 | CDD:278839 | |||
CUB | 844..957 | CDD:278839 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |