DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and tll2l

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001016661.1 Gene:tll2l / 549415 XenbaseID:XB-GENE-478930 Length:500 Species:Xenopus tropicalis


Alignment Length:171 Identity:64/171 - (37%)
Similarity:90/171 - (52%) Gaps:9/171 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYT 142
            |.:|:|:.|:::|:.| ...|::|..:|: :...||:||||....|||::|...    .|.....
 Frog   107 ITAAMQEFETLTCVDF-VPKTNEKNVINI-NNGNGCWSYIGRSGGVQQVSLSKQ----SCMVKGI 165

  Fly   143 IVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPY 207
            |.||..|.|||.|:...:|||.||.:|::||......|||   ....|:.|..|||.|||||...
 Frog   166 IQHELNHVLGFVHEHVRSDRDQYVNVVKKNILPDSLGNFD---IAVTNNLGLPYDYYSVMHYPRN 227

  Fly   208 AFSKNGERTILALEEGKEDVIGQRLELSETDIRKLNAIYKC 248
            |||.:.....|..:......||||..|:..||.|:|.:|.|
 Frog   228 AFSISPFLPTLITKPDPTIQIGQRYGLTNLDIAKINKLYNC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 64/171 (37%)
ZnMc_astacin_like 59..246 CDD:239807 62/167 (37%)
tll2lNP_001016661.1 ZnMc_hatching_enzyme 86..268 CDD:239810 63/169 (37%)
CUB 272..382 CDD:238001
CUB 385..495 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.