DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and tll2l

DIOPT Version :10

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001016661.1 Gene:tll2l / 549415 XenbaseID:XB-GENE-478930 Length:500 Species:Xenopus tropicalis


Alignment Length:171 Identity:64/171 - (37%)
Similarity:90/171 - (52%) Gaps:9/171 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYT 142
            |.:|:|:.|:::|:.| ...|::|..:|: :...||:||||....|||::|...    .|.....
 Frog   107 ITAAMQEFETLTCVDF-VPKTNEKNVINI-NNGNGCWSYIGRSGGVQQVSLSKQ----SCMVKGI 165

  Fly   143 IVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPY 207
            |.||..|.|||.|:...:|||.||.:|::||......|||   ....|:.|..|||.|||||...
 Frog   166 IQHELNHVLGFVHEHVRSDRDQYVNVVKKNILPDSLGNFD---IAVTNNLGLPYDYYSVMHYPRN 227

  Fly   208 AFSKNGERTILALEEGKEDVIGQRLELSETDIRKLNAIYKC 248
            |||.:.....|..:......||||..|:..||.|:|.:|.|
 Frog   228 AFSISPFLPTLITKPDPTIQIGQRYGLTNLDIAKINKLYNC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 ZnMc_astacin_like 59..246 CDD:239807 62/167 (37%)
tll2lNP_001016661.1 ZnMc_hatching_enzyme 86..268 CDD:239810 63/169 (37%)
CUB 272..382 CDD:238001
CUB 385..495 CDD:238001
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.