DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and c6ast3

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001013544.1 Gene:c6ast3 / 541399 ZFINID:ZDB-GENE-050320-99 Length:255 Species:Danio rerio


Alignment Length:202 Identity:71/202 - (35%)
Similarity:111/202 - (54%) Gaps:25/202 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 WPN------RIIYYHINSYIDEEHRNHIVSAIQK-IESIS---CLTFKEATTDQKYYVNVTSEEG 111
            ||.      .:.|...|.|...|     :..||: ::|.|   |:.| ....:::.|:::.| ..
Zfish    69 WPKYSDGKIYVPYVIANHYSSRE-----LEIIQRGLDSFSYSTCIRF-FPRGNERDYISIES-RS 126

  Fly   112 GCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEG 176
            ||:||:|.....|.::|..:    ||....|:.||.||||||.|:|:..|||:::|::.|||.:.
Zfish   127 GCYSYVGRQGYAQTVSLARS----GCLYHSTVQHELLHALGFNHEQTRNDRDNHIQVIWENILDD 187

  Fly   177 MEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGERTILALEEGKEDVIGQRLELSETDIRK 241
            |::||:|.  .|:|. |..|||.|||.|..|||||||..|::.:..... .:|...|:|:.||.:
Zfish   188 MKYNFNKV--NTLNQ-GTPYDYSSVMQYERYAFSKNGLPTMIPIPNNNA-ALGTSTEMSQNDIIR 248

  Fly   242 LNAIYKC 248
            :|.:|:|
Zfish   249 INRLYQC 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 71/202 (35%)
ZnMc_astacin_like 59..246 CDD:239807 67/196 (34%)
c6ast3NP_001013544.1 Astacin 68..255 CDD:279708 70/200 (35%)
ZnMc 74..255 CDD:294052 68/195 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.