DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and tll1

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001008039.1 Gene:tll1 / 493401 XenbaseID:XB-GENE-479941 Length:495 Species:Xenopus tropicalis


Alignment Length:221 Identity:73/221 - (33%)
Similarity:112/221 - (50%) Gaps:21/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IEGDMVPSGSSRNIWRNETYRWP---NRIIY--YHINSYIDEEHRNHIVSAIQKIESISCLTFKE 95
            |.|| :...:.||........||   :..:|  |.::|...::..|.|.:|:::.|.::|:.|..
 Frog    58 IHGD-IALKTDRNAINCTECLWPKSSDGFVYVPYTVSSDYSQDEVNAITTAMKEYEGLTCVQFTP 121

  Fly    96 ATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYT--IVHEFLHALGFFHQQS 158
            .|.:..|....:.:  ||:|||||....|.::|...      |..|.  :.||..|||||:|:.:
 Frog   122 WTGEDDYLAIQSLD--GCWSYIGYYGGSQAVSLLKG------FCAYNGGVQHELNHALGFYHEHN 178

  Fly   159 AADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSK-NGERTILALEE 222
            .:||||||.|:.:.|:.....||||.   :.|:.|..|||.|::||...|||. :|:.||:. ..
 Frog   179 RSDRDDYVTIMYQYISPENIGNFDKI---STNNLGVDYDYSSILHYAGNAFSNTSGQNTIVP-HP 239

  Fly   223 GKEDVIGQRLELSETDIRKLNAIYKC 248
            .....|||...||..|:.|:|.:|.|
 Frog   240 NPNVPIGQSYGLSNLDVLKINRLYGC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 68/202 (34%)
ZnMc_astacin_like 59..246 CDD:239807 64/191 (34%)
tll1NP_001008039.1 ZnMc_hatching_enzyme 83..265 CDD:239810 65/193 (34%)
CUB 269..379 CDD:238001
CUB 382..494 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.