DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and tld

DIOPT Version :10

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster


Alignment Length:196 Identity:62/196 - (31%)
Similarity:95/196 - (48%) Gaps:8/196 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 WPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTD-QKYYVNVTSEEGGCFSYIGYL 120
            |...:|.|.|::.....|:.....|::..|:.:|:.|.|...: ...|:..|.:..||.|::|..
  Fly   146 WDYGVIPYEIDTIFSGAHKALFKQAMRHWENFTCIKFVERDPNLHANYIYFTVKNCGCCSFLGKN 210

  Fly   121 NRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYT 185
            ..    ..|...||..|.:...|:||..|.:||.|:.:..|||.::.|.:.||..|.|:|||..:
  Fly   211 GN----GRQPISIGRNCEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQEYNFDVLS 271

  Fly   186 EETVNDFGEKYDYGSVMHYGPYAFSKN---GERTILALEEGKEDVIGQRLELSETDIRKLNAIYK 247
            .|.|:.....||..|:|||...:|||:   ...|.:.:..|....:|||..||..||.:.|.:||
  Fly   272 PEEVDLPLLPYDLNSIMHYAKNSFSKSPYLDTITPIGIPPGTHLELGQRKRLSRGDIVQANLLYK 336

  Fly   248 C 248
            |
  Fly   337 C 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 ZnMc_astacin_like 59..246 CDD:239807 58/190 (31%)
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 62/196 (32%)
CUB 388..474 CDD:214483
CUB 478..586 CDD:395345
FXa_inhibition 595..630 CDD:464251
CUB 634..750 CDD:395345
FXa_inhibition 757..792 CDD:464251
CUB 797..906 CDD:395345
CUB 910..1023 CDD:395345
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.