DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and CG6763

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster


Alignment Length:230 Identity:87/230 - (37%)
Similarity:128/230 - (55%) Gaps:11/230 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ETDPELTAGYIEGDM-VPSGS--SRNIWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKIES 87
            |.:||....|:|||| ||...  .:|....::.||||.::.|.|....:......|.:||.:...
  Fly    83 EMNPEELGSYLEGDMLVPQTDLIMKNGLPTQSSRWPNGVVPYEIRGNFNARDMATIENAIGEYHR 147

  Fly    88 ISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCF-RLYTIVHEFLHAL 151
            .:|:.|.:.::::. |:::..:..||:|.:|.:...|::|||:    .||. |..|.:||.:|||
  Fly   148 RTCIRFVKRSSERD-YISIRGDNSGCWSSVGRVGGKQEVNLQS----PGCLSRPGTAMHELMHAL 207

  Fly   152 GFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGERT 216
            ||.|:|:..:||.||.|...|:......||:|...  ...||..|||||||||...|||.||:.|
  Fly   208 GFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAAR--TEAFGVPYDYGSVMHYSKNAFSINGQPT 270

  Fly   217 ILALEEGKEDVIGQRLELSETDIRKLNAIYKCPTV 251
            |||::....|.:|||...|:.||:|||.:|.|.||
  Fly   271 ILAMQANGADKMGQRNGFSDYDIQKLNRMYDCGTV 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 74/195 (38%)
ZnMc_astacin_like 59..246 CDD:239807 69/187 (37%)
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 74/194 (38%)
ZnMc_astacin_like 119..300 CDD:239807 69/187 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444934
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115954at6960
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - otm46226
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.