Sequence 1: | NP_609758.1 | Gene: | CG15253 / 34916 | FlyBaseID: | FBgn0028948 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262840.1 | Gene: | Nrx-1 / 42646 | FlyBaseID: | FBgn0038975 | Length: | 1847 | Species: | Drosophila melanogaster |
Alignment Length: | 195 | Identity: | 40/195 - (20%) |
---|---|---|---|
Similarity: | 82/195 - (42%) | Gaps: | 61/195 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 YSILLLLLVVVNVAWAAPSIRIETDPELTAGY-IEGDMVPSGSSRNIWRNETY---RWPNRIIYY 64
Fly 65 HINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQ-QLNL 128
Fly 129 QNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENI-----TEGMEFNFDKYTEET 188
Fly 189 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15253 | NP_609758.1 | Astacin | 55..250 | CDD:279708 | 31/143 (22%) |
ZnMc_astacin_like | 59..246 | CDD:239807 | 29/136 (21%) | ||
Nrx-1 | NP_001262840.1 | LamG | 110..263 | CDD:238058 | 32/159 (20%) |
EGF_CA | 311..347 | CDD:238011 | |||
Laminin_G_2 | 386..517 | CDD:280389 | |||
LamG | 555..716 | CDD:238058 | |||
EGF | 746..777 | CDD:278437 | |||
Laminin_G_2 | 814..945 | CDD:280389 | |||
LamG | 988..1136 | CDD:238058 | |||
EGF | 1164..1195 | CDD:278437 | |||
Laminin_G_2 | 1233..1356 | CDD:280389 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45444940 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |