DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and MEP1A

DIOPT Version :10

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_011512930.1 Gene:MEP1A / 4224 HGNCID:7015 Length:774 Species:Homo sapiens


Alignment Length:223 Identity:83/223 - (37%)
Similarity:113/223 - (50%) Gaps:12/223 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LTAG--YIEGDMVPSGSSRNIWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTF 93
            |.||  ..:||::.. .|||..|:...||...|.|. :...:....:..|:.|.:.....||:.|
Human    76 LAAGLDLFQGDILLQ-KSRNGLRDPNTRWTFPIPYI-LADNLGLNAKGAILYAFEMFRLKSCVDF 138

  Fly    94 KEATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQS 158
            |....:..|.  :..:..||:|.:|     .|...||..||.||.....|.||.||||||:|:||
Human   139 KPYEGESSYI--IFQQFDGCWSEVG-----DQHVGQNISIGQGCAYKAIIEHEILHALGFYHEQS 196

  Fly   159 AADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGE-RTILALEE 222
            ..||||||.|..:.|..|.:.|||.|.:..:.|....|||.|:|||.|::|:||.. .||.|...
Human   197 RTDRDDYVNIWWDQILSGYQHNFDTYDDSLITDLNTPYDYESLMHYQPFSFNKNASVPTITAKIP 261

  Fly   223 GKEDVIGQRLELSETDIRKLNAIYKCPT 250
            ....:|||||:.|..|:.:||.:|.|.|
Human   262 EFNSIIGQRLDFSAIDLERLNRMYNCTT 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 ZnMc_astacin_like 59..246 CDD:239807 69/187 (37%)
MEP1AXP_011512930.1 ZnMc_meprin 58..287 CDD:239809 81/219 (37%)
MAM 292..459 CDD:214533
MATH_Meprin_Alpha 459..622 CDD:239752
EGF 702..736 CDD:394967
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.