DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and CG10280

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001246942.1 Gene:CG10280 / 40740 FlyBaseID:FBgn0037395 Length:362 Species:Drosophila melanogaster


Alignment Length:235 Identity:79/235 - (33%)
Similarity:119/235 - (50%) Gaps:17/235 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DPELTAGYIEGDM-------VPSGSSRNIWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKI 85
            |||......:||:       :......|..|:....|||..|.:.|:.....:.|..|:.|::..
  Fly   113 DPETMPRLFQGDIAIDPYTYITLRLGVNPMRHPKRLWPNGTIPFEISPRYANQERQAIIQAVKTF 177

  Fly    86 ESISCLTFKEATTDQKYYVNVTSE-EG--GCFSYIGYLNRVQQLNLQN-NEIGVGCFRLY-TIVH 145
            .|::|:.|.....:...|:.:... ||  ||:||:|.....|.::||. :|....||... .|:|
  Fly   178 NSLTCVHFVPYDGEVDDYLLIEPPLEGPQGCWSYVGRRGGEQVVSLQRPDENSAHCFSSEGRIMH 242

  Fly   146 EFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFS 210
            |.:||:|.:|:||.||||::|:|..:||......|| |...:....:...|||.||||||.:.||
  Fly   243 ELMHAIGIYHEQSRADRDNFVKIHWDNIVPRFRKNF-KLVSKKKGKYAFDYDYNSVMHYGEFYFS 306

  Fly   211 K-NGER-TILALEEGKEDVIGQRLELSETDIRKLNAIYKC 248
            | .||: |:..|:.|..  ||||..:|:.|..|:|.:|.|
  Fly   307 KRKGEKPTMTPLQPGVR--IGQRKTISKIDCLKINELYGC 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 72/201 (36%)
ZnMc_astacin_like 59..246 CDD:239807 68/193 (35%)
CG10280NP_001246942.1 Astacin 147..344 CDD:279708 71/199 (36%)
ZnMc_astacin_like 151..342 CDD:239807 68/193 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444903
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115954at6960
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.