DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and npsn

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_991319.2 Gene:npsn / 404039 ZFINID:ZDB-GENE-040420-2 Length:280 Species:Danio rerio


Alignment Length:192 Identity:67/192 - (34%)
Similarity:108/192 - (56%) Gaps:13/192 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IIY--YHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRV 123
            ::|  |.|:..........|...:|...::||:.| ...|.::.|:|:.| |.||:||:|.:...
Zfish    95 LVYVPYQISRAYSPREVAVIEQGLQSFSAVSCIRF-VPHTGERNYLNIKS-ESGCYSYLGRIGGG 157

  Fly   124 QQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEET 188
            |.::||..    ||....|:.||.||||||.|:|:.:|||::::|:.:||....::||:|   :.
Zfish   158 QVVSLQRQ----GCVYFSTVQHELLHALGFHHEQNRSDRDNHIRILYQNIIPAQQYNFNK---QN 215

  Fly   189 VNDFGEKYDYGSVMHYGPYAFSKNGERTILALEEGKEDVIGQRLELSETDIRKLNAIYKCPT 250
            .|:.|..|||.|||.|..||||.|.:.|::.:..... |:|:...:|..||.::|.:| |.|
Zfish   216 TNNLGTPYDYNSVMQYSRYAFSMNNQPTMVPVPNANV-VLGEAQSMSPNDILRINRLY-CST 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 66/190 (35%)
ZnMc_astacin_like 59..246 CDD:239807 64/186 (34%)
npsnNP_991319.2 Astacin 87..275 CDD:279708 66/190 (35%)
ZnMc_hatching_enzyme 93..273 CDD:239810 65/188 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.