DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and CG7631

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster


Alignment Length:224 Identity:108/224 - (48%)
Similarity:145/224 - (64%) Gaps:1/224 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ETDPELTAGYIEGDMVPSGSSRNIWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKIESISC 90
            ||||||||||.:||| ....:||...:||.||||..:.|.|:...|..|..:|...:|.||..||
  Fly    29 ETDPELTAGYFQGDM-DVDYARNGQLSETRRWPNATVPYRISEEFDAPHVEYIKLGMQFIEYSSC 92

  Fly    91 LTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFH 155
            :.|..|..|::.|:.|.....||.|.:||....:.:.|:...:..|||:|.||.||.||.|||.|
  Fly    93 IRFVPADEDEENYLFVLPSTSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHH 157

  Fly   156 QQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGERTILAL 220
            ||.:.:||::|:||||||:||.|.||.||.|:.|.||.:.|||||::||...|||.|||.||:||
  Fly   158 QQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAFSINGEATIVAL 222

  Fly   221 EEGKEDVIGQRLELSETDIRKLNAIYKCP 249
            ....::.:||||.:|:||:::||.:||||
  Fly   223 NPEGQEQMGQRLMMSDTDVKRLNTMYKCP 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 91/195 (47%)
ZnMc_astacin_like 59..246 CDD:239807 84/186 (45%)
CG7631NP_609760.1 Astacin 57..251 CDD:279708 89/193 (46%)
ZnMc_astacin_like 61..248 CDD:239807 84/186 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444897
Domainoid 1 1.000 145 1.000 Domainoid score I4540
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D109979at50557
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm9716
orthoMCL 1 0.900 - - OOG6_112325
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.