DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and CG15254

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster


Alignment Length:248 Identity:165/248 - (66%)
Similarity:200/248 - (80%) Gaps:2/248 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YSILLLLLVVVNVAWAAPSI--RIETDPELTAGYIEGDMVPSGSSRNIWRNETYRWPNRIIYYHI 66
            :::.|:::.:.:...|||:.  ||||||||||||||||||||...||..||||:||||||:||:|
  Fly     4 WALTLVVIFLASSCSAAPTTQNRIETDPELTAGYIEGDMVPSPEGRNGLRNETFRWPNRIVYYYI 68

  Fly    67 NSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNN 131
            |..||.||||||:..|:.||..|||.||||||||:||||||||.|||:||:||.|||||||||..
  Fly    69 NRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRNRVQQLNLQTY 133

  Fly   132 EIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKY 196
            .:..|||||.||||||||||||:||||..:|||||:|.|||||||.|.||:||..|||.|:||.|
  Fly   134 ALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDNETVEDYGEPY 198

  Fly   197 DYGSVMHYGPYAFSKNGERTILALEEGKEDVIGQRLELSETDIRKLNAIYKCP 249
            ||.||:||..||||||||.||:.|:||.|:::||||:::::||.|||.:||||
  Fly   199 DYSSVLHYTAYAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDINKLNVMYKCP 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 135/195 (69%)
ZnMc_astacin_like 59..246 CDD:239807 128/186 (69%)
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 133/192 (69%)
ZnMc_astacin_like 61..248 CDD:239807 128/186 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464496
Domainoid 1 1.000 202 1.000 Domainoid score I6324
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D109979at50557
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - otm46226
orthoMCL 1 0.900 - - OOG6_112325
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.