DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and Semp1

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster


Alignment Length:228 Identity:104/228 - (45%)
Similarity:141/228 - (61%) Gaps:8/228 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DPELTAGYIEGDMVPSG-SSRNIWRNETYRWPNRIIYYHI--NSYIDEEHRNHIVSAIQKIESIS 89
            ||||.||:.:||:.... .:||...|:.|.||||.:.|.|  :::.|..:| .|:.||..||..|
  Fly    23 DPELLAGFYQGDIKAHPIRTRNGIVNQIYHWPNRTVPYMIEDDAFADSHYR-EILRAISIIEENS 86

  Fly    90 CLTFKEAT-TDQKYYVNVTSEEGGCFS-YIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALG 152
            |:.||.|| .|....:.:||:..||.: ::||.|:.|.:||:...:|.||||:.:|:||.||.||
  Fly    87 CVIFKPATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLG 151

  Fly   153 FFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETV-NDFGEKYDYGSVMHYGPYAFSKNGERT 216
            |.||..:.:||.||.|..:||......||......|. :||.|.|||.|||||.|.|||:||:.|
  Fly   152 FEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFSRNGQPT 216

  Fly   217 ILALEEGKEDVIGQRLELSETDIRKLNAIYKCP 249
            |:.|.||.|: :|||..:||.||||||.:|:||
  Fly   217 IVPLREGAEN-MGQRFYMSEKDIRKLNKMYRCP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 93/200 (47%)
ZnMc_astacin_like 59..246 CDD:239807 87/191 (46%)
Semp1NP_609756.1 Astacin 53..249 CDD:279708 92/198 (46%)
ZnMc_astacin_like 55..245 CDD:239807 87/191 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444828
Domainoid 1 1.000 145 1.000 Domainoid score I4540
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D109979at50557
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.