DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and CG15255

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster


Alignment Length:254 Identity:112/254 - (44%)
Similarity:155/254 - (61%) Gaps:15/254 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLLVVVNVAWAAPSIRIETDPELTAGYIEGDMV-----------PSGSSRNIWRNETYRWPNR 60
            :|||.||:|.....|:  ...|||...|::||||:           .:..:||...|...|||..
  Fly     9 VLLLQVVLNSGKPLPA--GVYDPEEAGGFVEGDMMLTEEQQRNLEQGAPKARNGLINTEKRWPGN 71

  Fly    61 IIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQQ 125
            ::.|.|:...|..|:..|.:.|..:|..:||.|:|||.:.|.|:.||::.|||::.:||....|:
  Fly    72 VVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQGAPQE 136

  Fly   126 LNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVN 190
            :||:...:|.||||..||:|||:|||||:||||::.|||::.::.|||..|.||||.||.:..|.
  Fly   137 MNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVT 201

  Fly   191 DFGEKYDYGSVMHYGPYAFSKNGERTILALEEGKEDVIGQRLELSETDIRKLNAIYKCP 249
            ||...|||.|.:||.|.|||.|||.||:.|:...  |||||:.||..||.|:|.:||||
  Fly   202 DFEVGYDYDSCLHYRPGAFSINGEDTIVPLDSSA--VIGQRVGLSSKDIDKINIMYKCP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 94/195 (48%)
ZnMc_astacin_like 59..246 CDD:239807 87/186 (47%)
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 92/193 (48%)
ZnMc_astacin_like 70..255 CDD:239807 87/186 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444925
Domainoid 1 1.000 202 1.000 Domainoid score I6324
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D109979at50557
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - otm46226
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.