DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and Astl

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001099974.1 Gene:Astl / 296129 RGDID:1562279 Length:436 Species:Rattus norvegicus


Alignment Length:291 Identity:87/291 - (29%)
Similarity:133/291 - (45%) Gaps:58/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLLVVVNVAWAAPSI--------------------RIETD---PELTAGYI-----------E 37
            :|.||.:..:...|||.                    |:..|   |.:..|.|           |
  Rat    11 MLTLLSLTGLILGAPSASRCSGVCSTSVPEGFTPEGSRVSQDKDIPAINQGLISEETPESSFLVE 75

  Fly    38 GDMVPSGSSR--NIWRNETYRWPNRI-----IYYHINSYIDEEHRNHIVSAIQKIESISCLTFKE 95
            ||::.....|  ::..|   :||..:     |.:.::|..||..|..|:.|..:.|..:|:.| .
  Rat    76 GDIIRPSPFRLLSVTNN---KWPKGVDGIVEIPFLLSSKYDEPSRQVIMEAFAEFERFTCIRF-V 136

  Fly    96 ATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNN--EIGVGCFRLYTIVHEFLHALGFFHQQS 158
            |...|:.:|::. ...||||.:|....:|.::|...  :.|.|     .::||.:|.|||:|:.|
  Rat   137 AYRGQRDFVSIL-PMAGCFSGVGRSGGMQVVSLAPTCLQKGRG-----IVLHELMHVLGFWHEHS 195

  Fly   159 AADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGERTILALEEG 223
            .||||.|:::....|..|.|.||.|...   ::....|||.||||||.:|||..|:.||:.|...
  Rat   196 RADRDRYIRVNWNEILPGFEINFIKSRN---SNMLAPYDYSSVMHYGRFAFSWRGQPTIIPLWTS 257

  Fly   224 KEDVIGQRLELSETDIRKLNAIYKC-PTVKE 253
            ... ||||..||.:||.::..:|.| |:|.:
  Rat   258 SVH-IGQRWNLSTSDITRVCRLYSCSPSVPD 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 69/202 (34%)
ZnMc_astacin_like 59..246 CDD:239807 65/193 (34%)
AstlNP_001099974.1 Astacin 92..283 CDD:279708 70/204 (34%)
ZnMc 99..281 CDD:294052 66/192 (34%)
ImpA_N <305..420 CDD:303075
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - otm46226
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.