DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and Mep1b

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_037315.1 Gene:Mep1b / 25727 RGDID:3081 Length:704 Species:Rattus norvegicus


Alignment Length:223 Identity:83/223 - (37%)
Similarity:124/223 - (55%) Gaps:7/223 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ETDPELTAGYIEGDMVPSGSSRNIWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKIESISC 90
            :.:.:|.....|||:....|.||....:.||||:.|.|. :...::...:..|::|.::....:|
  Rat    41 DINEDLGLDLFEGDIKLEASGRNSIIGDNYRWPHTIPYV-LEDSLEMNAKGVILNAFERYRLKTC 104

  Fly    91 LTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFH 155
            :.||..:.::. |::| .:..||:|.:|.::    ...|...||..|.|:.|:.|||||||||:|
  Rat   105 IDFKPWSGEEN-YISV-FKGSGCWSSVGNIH----AGKQELSIGTNCDRIATVQHEFLHALGFWH 163

  Fly   156 QQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGERTILAL 220
            :||.||||||:.||.:.|..|.|.||:.|.:...:.....|||.|||||...||....|.||:..
  Rat   164 EQSRADRDDYITIVWDRILSGKEHNFNIYNDSVSDSLNVPYDYTSVMHYSKTAFQNGTESTIITK 228

  Fly   221 EEGKEDVIGQRLELSETDIRKLNAIYKC 248
            ....|||||||::.|:.|:.|||.:|.|
  Rat   229 ISDFEDVIGQRMDFSDYDLLKLNQLYSC 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 76/194 (39%)
ZnMc_astacin_like 59..246 CDD:239807 70/186 (38%)
Mep1bNP_037315.1 ZnMc 30..256 CDD:294052 82/221 (37%)
Astacin 70..258 CDD:279708 76/194 (39%)
MAM 266..430 CDD:279023
MAM 266..428 CDD:99706
MATH 428..586 CDD:295307
EGF_CA 609..647 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46226
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.