DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and Tnfaip6

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_033424.1 Gene:Tnfaip6 / 21930 MGIID:1195266 Length:275 Species:Mus musculus


Alignment Length:67 Identity:15/67 - (22%)
Similarity:27/67 - (40%) Gaps:20/67 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCYYSILLLLLVVVNVAWAAPSIRIETDPELTAGYIE----------------GDMVPSG--SSR 47
            :||:.|.|.....:::::.  ...:|.||...|.|:|                ||.:|..  |:.
Mouse   160 VCYWHIRLKYGQRIHLSFL--DFDLEHDPGCLADYVEIYDSYDDVHGFVGRYCGDELPEDIISTG 222

  Fly    48 NI 49
            |:
Mouse   223 NV 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708
ZnMc_astacin_like 59..246 CDD:239807
Tnfaip6NP_033424.1 Link_domain_TSG_6_like 36..128 CDD:239592
CUB 135..244 CDD:278839 15/67 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..275
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.