DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and Y19D10A.6

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_503652.3 Gene:Y19D10A.6 / 189484 WormBaseID:WBGene00021221 Length:272 Species:Caenorhabditis elegans


Alignment Length:247 Identity:63/247 - (25%)
Similarity:99/247 - (40%) Gaps:76/247 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GYIEGDMVPSGSSRNI------WRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLT 92
            |:|.   :|....|.|      |  .:|.|||..:.|.|.::.....::.|:||::..::::|:.
 Worm    36 GHIN---IPLRKKRGIALHPLQW--ASYLWPNAEVPYDIATHYTSTEKSIILSAMEAFKNVTCVR 95

  Fly    93 FK-EATTDQKY-----YVNVTSEEGGCFSYIGYLN----------------RVQQLNLQNNEIGV 135
            |: .|.||:.|     |.||..    ||||||..:                |:....|:.|..|:
 Worm    96 FRPRAATDKHYLQINKYFNVER----CFSYIGRQSSRTLFGTPEGNVETRMRLDPACLRGNGRGI 156

  Fly   136 GCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGS 200
                   ::||.:|.|||:|:....|||..:      :...:.:||..|........| .||..|
 Worm   157 -------VMHELMHILGFYHEHQRDDRDRRI------VGSAVHYNFKIYRRAKTLYMG-AYDANS 207

  Fly   201 VMHYG----PYAFSKNGERTILALEEGKEDVIGQRLELSETDIRKLNAIYKC 248
            :|||.    |:.                     :|...|.:||..:|..|||
 Worm   208 IMHYNFQNLPWQ---------------------RRDHFSTSDIININTFYKC 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 57/220 (26%)
ZnMc_astacin_like 59..246 CDD:239807 51/212 (24%)
Y19D10A.6NP_503652.3 Astacin 58..240 CDD:279708 57/220 (26%)
ZnMc 62..236 CDD:294052 51/212 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.