DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and nas-3

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_505445.2 Gene:nas-3 / 187045 WormBaseID:WBGene00003522 Length:292 Species:Caenorhabditis elegans


Alignment Length:274 Identity:68/274 - (24%)
Similarity:116/274 - (42%) Gaps:60/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YYSILLLLLVVVN-------VAWAAPSIRIETDPELTAGYIEGDM---VPSGSSRNI----WRNE 53
            ::|:|.|....|:       :|...|:.|..::|..     :.|:   :|....|.|    |:.|
 Worm     7 FFSLLALTASKVSEPEKDDEIAVKIPTKRSVSEPPK-----DDDIAVKIPMRKKRGIAIHPWQWE 66

  Fly    54 TYRWPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTS--EEGGCFSY 116
            ::.|||..:.|.|.|:.....|..|:||::....::|:.|:...:..|:|:.:..  :...||||
 Worm    67 SHLWPNAEVPYDIASHYTATERGIILSAMEAFRDVTCVRFRPRRSTDKHYLQINKHYQLERCFSY 131

  Fly   117 IGYLNRVQQLNLQNNEIGV------GCFRLY----TIVHEFLHALGFFHQQSAADRDDYVQIVEE 171
            ||..:.......::.::..      .|. ||    |::||.:|.|||:|:....|||..:.    
 Worm   132 IGRQSSRWLFGTRDGKVETRMKLDPSCL-LYNGRGTVMHELMHILGFYHEHQRDDRDRRIG---- 191

  Fly   172 NITEGMEFNFDKYTEETVNDFGEKYDYGSVMHY--GPYAFSKNGERTILALEEGKEDVIGQRLEL 234
              .....:||..| :...:.:...||..|:|||  |...:.|                   |...
 Worm   192 --GSASHYNFKIY-QRAKSYYMGGYDANSIMHYNFGSVPWQK-------------------RDYF 234

  Fly   235 SETDIRKLNAIYKC 248
            |.:|||.:|.:|||
 Worm   235 SPSDIRNINTLYKC 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 54/208 (26%)
ZnMc_astacin_like 59..246 CDD:239807 49/200 (25%)
nas-3NP_505445.2 Astacin 69..250 CDD:279708 54/207 (26%)
ZnMc 72..246 CDD:294052 49/200 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.